PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G36080.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 1560aa    MW: 174038 Da    PI: 8.8924
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G36080.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.33.3e-19142314753385
                       -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
               B3   33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85  
                       ++ l +ed +g++W+++++ +++s++yvltkGW++Fv+++gL++gD++vF+ +
  ONIVA02G36080.2 1423 GVLLNFEDGEGKVWRFRYSCWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSGS 1475
                       56799*********************************************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF032543.2E-180265728IPR004938Xyloglucan fucosyltransferase
PfamPF032542.3E-1928381290IPR004938Xyloglucan fucosyltransferase
SMARTSM010190.005613471490IPR003340B3 DNA binding domain
SuperFamilySSF1019361.57E-1614201477IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.6E-2014211491IPR015300DNA-binding pseudobarrel domain
PfamPF023622.1E-1614221475IPR003340B3 DNA binding domain
PROSITE profilePS5086311.51914261490IPR003340B3 DNA binding domain
CDDcd100171.80E-1414281472No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0036065Biological Processfucosylation
GO:0042546Biological Processcell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0008107Molecular Functiongalactoside 2-alpha-L-fucosyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1560 aa     Download sequence    Send to blast
MYYVRGAGGS WEKAESEACV HESARRRGVP MDEKRAARTP RAGARNAVNG GESGCCSEKA  60
ARWGWRAPVE VAVVGFVATL TLLVLLYGGT GSLLSFTSPR TEFVRKLAAD KRGRRGWAAA  120
GGGVARGGGG AGDGRDGEDK CRPAMEAAEA GSMAWRTAVR GRQRSARTTV RPTVAGAIGA  180
ERRGQAGGGG EAGTMGMGGG LVSTFSRMLR SNRMLAGLRL RCTSDSGLVW WRNSSAVVIS  240
AEILNRWLHG IDGRRLQLHR AAAAASPSHG APEDTPESST RHDDDRLLGG LLSQAFDEHS  300
CRSRYTSSLY RRRSPFRPST YLVERLRRYE ARHKRCGPGS ALFQEAVEHL RSGRNAARSE  360
CQYVVWTPFN GLGNRMLALA STFLYALLTD RVLLVHAPPE FDGLFCEPFP GSSWTLPADF  420
LITDFDGVFT MWSPTSYKNM RQAGTISNAT AEQSLPAYVF LDLIQSFTDA AFCDDDQQVL  480
AKFNWMVIKS DVYFAAMLFL MPAYERELTQ LFPEKEAVFH HLARYLFHPS NDVWGIVHRF  540
YEAYLARADE LVGLQVRVFP EMPIPFDNMY EQIIRCSEQE GLLPKLGQTV VVTAANGSSV  600
VAPSTKLTSI LVTSLFPDYY DRIRGVYHAR PTETGEYVAV HQPSHEREQR TEARGHNQRA  660
LAEIYLLSFC DRVVTSAVST FGYIAHGLAG VRPWVLLRPP SPVARAEPAC VRSETVEPCL  720
QALPRRMCGA AEGSDIGALV PHIRHCEDVQ KGVKLGWPPA GRAAENEARR WGRLRRASAR  780
AALVLCSLTM IPVVVVLHRC AVSSSWPDRV FEAKHIAGAG EQDMQDDLPD DLTASQYIGY  840
DKFLGGLLQE GFDEVSCRSR YQFARYHKNF TRIPSSYLLE RLRRQEALQK KCGPGTKSYK  900
QAVKLLRSSQ GVNMTTDCNY LFLTVHAGLG NRMLEIASAF LYALLTNRIL LLDRYQEIGD  960
LFCEPFPGTS WLMPSDFPLN YGEFTQSSPE SYGNMQQNKV VGDNTDRSLA GFRPPYVFLY  1020
LDGNYEFHDK LFFCEDDQQF LQDVPWLIMR TDMYFIPSLF LIPSYQDELS RLFPEKDAVF  1080
HHLARYLFHP TNSIWYSVKG YYRSYLAKAN KTVGIQIRIF EKEGILQKNG RFPYVLEQIL  1140
SCAQNEKLLP EISMKDEAEA PTATKNNQTI AVLTTSLSSW YSDQIQKKYS EHPTVDGTRV  1200
EVYQPSHEEY QRSKNKKHNM KALAEIYLLS MTDVLITSGF STFGYAAQGL SGLTPWIMFR  1260
SENHAMPDPP CRRAMSIEPC FHQAPFYDCK AKRNADLGKM VPFVRHCEDV SWGLKVVLAA  1320
KSQMGVWEAE LVGKGSEIGL AITLLPLLAV FLLGENVRLA VNDFAKAHQP AGTSDTNTSA  1380
FRRRQAQPPA GAQAARGEAL PAAADELRRL RHRRRGHLQL CKGVLLNFED GEGKVWRFRY  1440
SCWNSSQSYV LTKGWSRFVR EKGLRAGDTI VFSGSAYGPD KLLFIDCKKN NTAAATGDEK  1500
PITSGEATRV VRLFGMDITG GGGDCRKRER AVEMGQEAFL MKRQCVHSTP HYTVRSAKAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A1e-241401148820115DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1009770.0AK100977.1 Oryza sativa Japonica Group cDNA clone:J023143L21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626866.10.0PREDICTED: probable fucosyltransferase 8 isoform X2
TrEMBLA0A0E0GDC40.0A0A0E0GDC4_ORYNI; Uncharacterized protein
STRINGBGIOSGA009101-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13260.15e-27related to ABI3/VP1 1